Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFI VQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDY RA
    • Amino acids
      19 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCUR1
    • Breast cancer up regulated 1
    • Breast cancer upregulated 1
    • Gm366
    • Ldoc1
    • LDOC1_HUMAN
    • Leucine zipper down regulated in cancer 1
    • Leucine zipper protein down regulated in cancer cells
    • Leucine zipper protein down-regulated in cancer cells
    • Mar7
    • Mart7
    • Protein LDOC1
    • RGD1565644
    see all
  • Function
    May have an important role in the development and/or progression of some cancers.
  • Tissue specificity
    Ubiquitously expressed with high levels in brain ant thyroid and low expression in placenta, liver and leukocytes. Expressed as well in six of the seven human breast cancer cell lines examined.
  • Sequence similarities
    Belongs to the LDOC1 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161734 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up