Description

  • Product name

    Recombinant human LEC protein
    See all LEC proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract total human monocytes using a concentration range of 10.0 -100.0 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNR E VCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
    • Predicted molecular weight

      11 kDa
    • Amino acids

      24 to 120
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab202776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C-C motif chemokine 16
    • CCL16
    • CCL16_HUMAN
    • Chemokine (C-C motif) ligand 16
    • Chemokine CC-4
    • Chemokine LEC
    • CKb12
    • HCC-4
    • HCC4
    • IL-10-inducible chemokine
    • IL10 inducible chemokine
    • ILINCK
    • LCC-1
    • LCC1
    • Liver CC chemokine 1 precursor
    • Liver expressed chemokine
    • Liver-expressed chemokine
    • LMC
    • Lymphocyte and monocyte chemoattractant
    • Monotactin 1
    • Monotactin-1
    • MTN-1
    • Mtn1
    • NCC-4
    • NCC4
    • New CC chemokine 4
    • SCYA16
    • SCYL4
    • Small inducible cytokine A16 precursor
    • Small inducible cytokine subfamily A (Cys Cys) member 16
    • Small-inducible cytokine A16
    see all
  • Function

    Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
  • Tissue specificity

    Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up