Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISG AVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLET FKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQ SISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFW LKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQ EDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPL GGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 334

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BRICD3
    • BRICHOS domain containing 3
    • CH-SP
    • CHM I
    • ChM-I
    • CHM1
    • chondromodulin
    • Chondromodulin I
    • Chondromodulin-1
    • Chondromodulin-I
    • Chondrosurfactant protein
    • LECT 1
    • Lect1
    • LECT1_HUMAN
    • Leukocyte cell derived chemotaxin 1
    • Multiple myeloma tumor suppressor 1
    • MYETS1
    see all
  • Function

    Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.
  • Tissue specificity

    Detected in cartilage and cardiac valves (at protein level). Detected in the laminae fibrosa, spongiosa and ventricularis layers of normal cardiac valves (at protein level). Expression is decreased cardiac valves of patients with valvular heart disease (at protein level). Weakly expressed in chondrosarcoma.
  • Sequence similarities

    Belongs to the chondromodulin-1 family.
    Contains 1 BRICHOS domain.
  • Developmental stage

    Expressed at 9 weeks in developing cartilagenous bone rudiments.
  • Post-translational
    modifications

    After cleavage, the post-translationally modified ChM-I is secreted as a glycoprotein.
  • Cellular localization

    Endomembrane system and Secreted. Accumulated in the inter-territorial matrix of cartilage.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132773 stained with Coomassie Blue.

References

ab132773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up