Overview

  • Product name

    Recombinant Human Lefty protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEE LVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLV FGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWL RVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQ VSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGD CDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQK CSCASDGALVPRRLQP
    • Molecular weight

      66 kDa including tags
    • Amino acids

      1 to 366

Specifications

Our Abpromise guarantee covers the use of ab132267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI450052
    • Ebaf
    • Left right determination factor
    • Left right determination factor 1
    • Left right determination factor B
    • left-right determination factor
    • LEFT-RIGHT DETERMINATION FACTOR 1; LEFTY1
    • left-right determination, factor B
    • LEFT-RIGHT DETERMINATION, FACTOR B; LEFTY B
    • LEFTB
    • Lefty
    • LEFTY 1
    • lefty-1
    • LEFTY1
    • LEFTY1, MOUSE, HOMOLOG OF
    • LEFTYB
    • OTTHUMP00000035572
    • Protein lefty-1
    • Protein lefty-B
    • RGD1561867
    • Stimulated by retinoic acid gene 3 protein
    • STRA3
    • TGF beta 4
    • TGF-beta-4
    • Tgfb4
    • Transforming growth factor beta 4
    • Transforming growth factor beta-4
    see all
  • Relevance

    During vertebrate embryogenesis, a left right axis is established. Secreted growth factors of the TGF beta family, including gene products derived from nodal, lefty 1 and lefty 2, play crucial roles in establishing left right asymmetries. TGF beta (Transforming growth factor beta) is a pleiotropic cytokine that regulates growth and differentiation of diverse types of cells. TGF beta actions are directed by ligand induced activation of TGF beta receptors. Complexes formed move into the nucleus, where they act as components of a transcriptional complex. Lefty, a novel member of the TGF beta superfamily, inhibits TGF beta signaling. Lefty acts to inhibit phosphorylation of Smad2 following activation of the TGF beta receptor. Lefty also inhibits events downstream from R Smad phosphorylation. Lefty provides a repressed state of TGF beta responsive genes. The Lefty family is comprised of Lefty 1 and Lefty 2 in mouse, and Lefty A and Lefty B in humans. Members of the TGF beta superfamily require processing for their activation. Cleavage is therefore an essential step for Lefty activation. Lefty is synthesized as a large inactive precursor (41 Kda) that must be endoproteolytically processed to release the bioactive polypeptide (28 kDa and 34 kDa forms). The 28kDa form induces MAPK activity.
  • Cellular localization

    Secreted

Images

  • 12.5% SDS-PAGE analysis of ab132267 stained with Coomassie Blue.

References

ab132267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up