Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVV MMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLR GDAEAVKGIGSGKVLKSGPQDHVFIYFTDHGSTGILVFPNEDLHVKDLNE TIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYA CYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVM QYGNKTISTMKVMQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRK LMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLS ERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPL HRIKLSMDHVCLGHYVDHHHHHH
    • Molecular weight

      49 kDa including tags
    • Amino acids

      18 to 433
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151680 is more than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • AEP
    • Asparaginyl endopeptidase
    • cysteine 1
    • Cysteine protease 1
    • EC 3.4.22.34
    • Legumain
    • LGMN
    • LGMN_HUMAN
    • LGMN1
    • Protease
    • Protease cysteine 1
    • Protease cysteine 1 (legumain)
    • PRSC1
    see all
  • Function

    Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system.
  • Tissue specificity

    Ubiquitous. Particularly abundant in kidney, heart and placenta.
  • Sequence similarities

    Belongs to the peptidase C13 family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Lysosome.
  • Information by UniProt

References

ab151680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up