Description

  • Product name

    Recombinant Human Legumain protein (Tagged)
    See all Legumain proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab198767 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFVPIDDPEDGGKHWVVIVAGSN GWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIAYSEDNPTPGIVIN RPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQ DHVFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEA CESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLGDWYSVNWM EDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKVMQFQGMKR KASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRH LDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRT HCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      18 to 433
    • Additional sequence information

      This is the mature protein without the signal peptide expressed with a 29 amino acid N-terminal T7-His-TEV cleavage tag.

Specifications

Our Abpromise guarantee covers the use of ab198767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • AEP
    • Asparaginyl endopeptidase
    • cysteine 1
    • Cysteine protease 1
    • EC 3.4.22.34
    • Legumain
    • LGMN
    • LGMN_HUMAN
    • LGMN1
    • Protease
    • Protease cysteine 1
    • Protease cysteine 1 (legumain)
    • PRSC1
    see all
  • Function

    Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system.
  • Tissue specificity

    Ubiquitous. Particularly abundant in kidney, heart and placenta.
  • Sequence similarities

    Belongs to the peptidase C13 family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Lysosome.
  • Information by UniProt

References

ab198767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up