Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPD VPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL
    • Amino acids
      96 to 192
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1-acylglycerophosphatidylinositol O-acyltransferase
    • Bladder and breast carcinoma-overexpressed gene 1 protein
    • h-mboa-7
    • Leukocyte receptor cluster member 4
    • LPIAT
    • LPLAT 7
    • Lyso-PI acyltransferase
    • Lysophosphatidylinositol acyltransferase
    • Lysophospholipid acyltransferase 7
    • MBOA7_HUMAN
    • Mboat7
    • Membrane-bound O-acyltransferase domain-containing protein 7
    • O-acyltransferase domain-containing protein 7
    see all
  • Function
    Acyltransferase which mediates the conversion of lysophosphatidylinositol (1-acylglycerophosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3-phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
  • Tissue specificity
    Overexpressed in metastatic breast and bladder carcinomas relative to normal breast epithelium and urothelium.
  • Pathway
    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163989 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up