Description

  • Product name

    Recombinant Human LEO1/RDL protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADMEDLFGSDADSEAERKDSDSGSDSDSDQENAASGSNASGSESDQDER GDSGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDND PSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDK SDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDE RQQLSEEEKANSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDER PQASDEEHRHSDDEEEQDHKSESARGSDSEDEVLRMKRKNAIASDSEADS DTEVPKDNSGTMDLFGGADDISSGSDGEDKPPTPGQPVDENGLPQDQQEE EPIPETRIEVEIPKVNTDLGNDLYFVKLPNFLSVEPRPFDPQYYEDEFED EEMLDEEGRTRLKLKVENTIRWRIRRDEEGNEIKESNARIVKWSDGSMSL HLGNEVFDVYKAPLQGDHNHLFIRQGTGLQGQAVFKTKLTFRPHSTDSAT HRKMTLSLADRCSKTQKIRILPMAGRDPECQRTEMIKKEEERLRASIRRE SQQRRMREKQHQRGLSASYLEPDRYDEEEEGEESISLAAIKNRYKGGIRE ERARIYSSDSDEGSEEDKAQRLLKAKKLTSDEEGEPSGKRKAEDDDKANK KHKKYVISDEEEEDDD
    • Predicted molecular weight

      102 kDa including tags
    • Amino acids

      1 to 666

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as LEO1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gm185
    • LEO1
    • LEO1_HUMAN
    • LOC123439
    • Paf1/RNA polymerase II complex component
    • Replicative senescence down regulated leo1 like protein
    • Replicative senescence down-regulated leo1-like protein
    • Replicative senescence downregulated leo1 like
    • RNA polymerase associated protein LEO1
    • RNA polymerase-associated protein LEO1
    • Senescence downregulated leo1 like
    see all
  • Function

    The PAF1 complex is a multifunctional complex. The PAF1 complex interacts with POLR2A. May be involved in both initiation and elongation, histone methylation and RNA processing. Overexpression of LEO1 induces cell growth arrest and premature senescence of fibroblasts.
  • Tissue specificity

    Highly expressed in skeletal muscle and heart. Weakly expressed in placenta and liver.
  • Sequence similarities

    Belongs to the LEO1 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab132311 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up