Recombinant human Leptin protein (ab168049)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 98% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human Leptin protein
See all Leptin proteins and peptides -
Biological activity
ab168049 induces proliferation of BAF/3 cells stably transfected with the long form of Human leptin receptor. -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILT LSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPW ASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC -
Predicted molecular weight
16 kDa -
Amino acids
22 to 167
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab168049 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
ab168049 induces proliferation of BAF/3 cells stably transfected with the long form of Human leptin receptor. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituent: 0.038% Sodium bicarbonate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile water or 0.4% sodium bicarbonate, pH 8-9. Do not reconstitute to less than 0.1mg/ml. Further dilutions should be made with medium containing 0.1% HSA or BSA. After reconstitution, prepare aliquots and freeze in liquid nitrogen. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- FLJ94114
- LEP
- LEP_HUMAN
see all -
Function
May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass. -
Involvement in disease
Defects in LEP may be a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. -
Sequence similarities
Belongs to the leptin family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab168049 has not yet been referenced specifically in any publications.