Bioactive grade

Recombinant human Leptin protein (Animal Free) (ab222359)

Description

  • Product name

    Recombinant human Leptin protein (Animal Free)
    See all Leptin proteins and peptides
  • Biological activity

    The activity is determined by the leptin-dependent stimulation of mouse BaF/3 proliferation and is typically 0.4-2 ng/ml. This corresponds to an expected specific activity of 2.5 x 106 units/mg.

  • Purity

    95 % SDS-PAGE.
    Determined by reducing and non-reducing SDS-PAGE, UV spectroscopy at 280 nm.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
    • Predicted molecular weight

      16 kDa
    • Amino acids

      22 to 167
    • Additional sequence information

      This product is the mature full length chain. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab222359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • FLJ94114
    • LEP
    • LEP_HUMAN
    • LEPD
    • Leptin
    • Leptin (murine obesity homolog)
    • Leptin (obesity homolog, mouse)
    • Leptin Murine Obesity Homolog
    • Leptin Precursor Obesity Factor
    • OB
    • Obese protein
    • Obese, mouse, homolog of
    • Obesity
    • Obesity factor
    • Obesity homolog mouse
    • Obesity Murine Homolog Leptin
    • OBS
    • OTTHUMP00000212285
    see all
  • Function

    May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
  • Involvement in disease

    Defects in LEP may be a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities

    Belongs to the leptin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab222359
  • 1 µg ab222359 analyzed on a 4-20% Tris-Glycine gel under non-reducing conditions, stained with Coomassie Blue.

     

References

ab222359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up