Description

  • Product name

    Recombinant Human Leptin Receptor protein
    See all Leptin Receptor proteins and peptides
  • Purity

    > 98 % SDS-PAGE.
    >98 % by HPLC.
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPK FNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQ QIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLED SPLVPQKGSFQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVI FQSPLMSVQPINMVKPDPPLGLHMEITDDGNLKISWSSPPLVPFPLQYQV KYSENSTTVIREADKIVSATSLLVDSILPGSSYEVQVRGKRLDGPGIWSD WSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMN LAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHR YAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSL YCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGS LDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQ IRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGL GYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMK NDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINS IGASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMY FIIEWKNLNEDGEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGV GKPKIINSFTQDDIEKHQSD
    • Predicted molecular weight

      94 kDa
    • Amino acids

      22 to 839
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab245807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    As a result of glycosylation, ab245807 migrates with an apparent molecular mass of approximately 130-150 kDa by SDS-PAGE gel, under reducing and non-reducing conditions.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.80
    Constituent: 0.16% Sodium phosphate

  • Reconstitution
    Reconstitute in water to 1.0-5.0 mg/ml.

General Info

  • Alternative names

    • CD 295
    • CD295
    • CD295 antigen
    • Db
    • Fa
    • HuB219
    • LEP R
    • LEP-R
    • LEPR
    • LEPR_HUMAN
    • LEPRD
    • Leptin receptor
    • Leptin receptor fatty
    • Leptin receptor gene related protein
    • Leptin receptor precursor
    • OB R gene related protein
    • OB receptor
    • OB-R
    • OB-RGRP
    • obl
    • Obr
    see all
  • Function

    Receptor for obesity factor (leptin). On ligand binding, mediates signaling through JAK2/STAT3. Involved in the regulation of fat metabolism and, in a hematopoietic pathway, required for normal lymphopoiesis. May play a role in reproduction. Can also mediate the ERK/FOS signaling pathway.
  • Tissue specificity

    Isoform A is expressed in fetal liver and in hematopoietic tissues and choroid plexus. In adults highest expression in heart, liver, small intestine, prostate and ovary. Low level in lung and kidney. Isoform B is highly expressed in hypothalamus.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 4 fibronectin type-III domains.
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Domain

    The cytoplasmic domain may be essential for intracellular signal transduction by activation of JAK tyrosine kinase and STATs.
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications

    On ligand binding, phosphorylated on two conserved C-terminal tyrosine residues (isoform B only) by JAK2. Tyr-986 is required for complete binding and activation of PTPN11, ERK/FOS activation and, for interaction with SOCS3 (By similarity). Phosphorylation on Tyr-1141 is required for STAT3 binding/activation.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab245807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up