Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNL RSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQE IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT PSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPC YLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGG PYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGEL QNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLY SPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDLSSHQL NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWED AIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT AMLVGKDLKVDDYKDDDDKHHHHHH
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 611
    • Tags

      His tag C-Terminus , DDDDK tag C-Terminus
    • Additional sequence information

      NM_000895.

Specifications

Our Abpromise guarantee covers the use of ab198440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab198440 was purified by affinity chromatography.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Leukotriene A4 hydrolase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 0.68% Imidazole
    Constituents: 0.64% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • FLJ17564
    • Leukotriene A(4) hydrolase
    • Leukotriene A-4 hydrolase
    • Leukotriene A4 hydrolase
    • LKHA4_HUMAN
    • LTA-4 hydrolase
    • LTA4
    • LTA4 hydrolase
    • LTA4H
    see all
  • Function

    Hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.
  • Pathway

    Lipid metabolism; leukotriene B4 biosynthesis.
  • Sequence similarities

    Belongs to the peptidase M1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2.8 µg ab198440 with Coomassie staining.

References

ab198440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up