Overview

  • Product name

    Recombinant Human LGALS3BP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCD NLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASL ADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQ RGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAE CVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQGYCASLFAIL LPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPM MLPEELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLT EDTYKPRIYTSPTWSAFVTDSSWSARKSQLVYQSRRGPLVKYSSDYFQAP SDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCWNYGFSCSSDE LPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGWKAATPSALDT NSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD
    • Molecular weight

      90 kDa including tags
    • Amino acids

      1 to 585

Specifications

Our Abpromise guarantee covers the use of ab132454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 90K
    • 90K MAC 2 BP
    • Basement membrane autoantigen p105
    • BTBD17B
    • Galectin 3 binding protein
    • Galectin-3-binding protein
    • L3 antigen
    • Lectin galactoside binding soluble 3 binding protein
    • Lectin galactoside-binding soluble 3-binding protein
    • LG3BP_HUMAN
    • LGALS3BP
    • M2BP
    • Mac 2 binding protein
    • Mac 2 BP
    • Mac-2 BP
    • Mac-2-binding protein
    • Mac2 BP
    • MAC2BP
    • Serum protein 90K
    • TANGO10B
    • Transport and golgi organization 10 homolog B
    • Tumor associated antigen 90K
    • Tumor-associated antigen 90K
    see all
  • Function

    Promotes intergrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
  • Tissue specificity

    Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts.
  • Sequence similarities

    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Secreted. Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132454 on a 12.5% gel stained with Coomassie Blue.

References

ab132454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up