Recombinant Human LHFPL5 protein (ab165995)

Description

  • Product name

    Recombinant Human LHFPL5 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWI GDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFF VALGMFLIIGSIICFSLFFICNTATVYKICAWMQLAAATGLMIGCLVYPD GWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLG YRQDKLLPDDYKADGTEEV
    • Amino acids

      1 to 219
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deafness, autosomal recessive 67
    • DFNB67
    • dJ510O8.8
    • LHFP-like protein 5
    • LHFPL5
    • Lipoma HMGIC fusion partner-like 5
    • Lipoma HMGIC fusion partner-like 5 protein
    • MGC33835
    • OTTHUMP00000016278
    • Tetraspan membrane protein of hair cell stereocilia
    • TMHS
    • TMHS_HUMAN
    see all
  • Function

    May function in hair bundle morphogenesis.
  • Involvement in disease

    Defects in LHFPL5 are a cause of deafness autosomal recessive type 67 (DFNB67) [MIM:610265]. DFNB67 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the LHFP family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab165995 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up