Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRA ALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSI YCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKML TTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAG LGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNEND AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGPA SELSNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQT TLTNLF
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 406

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.

     This product was previously labelled as Lhx2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hLhx2
    • Homeobox protein LH-2
    • Homeobox protein LH2
    • LH2
    • LHX2
    • LHX2_HUMAN
    • LIM homeobox 2
    • LIM homeobox protein 2
    • LIM HOX gene 2
    • LIM/homeobox protein Lhx2
    see all
  • Function

    Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Domain

    LIM domains are necessary for transcription activation.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132482 stained with Coomassie Blue

References

ab132482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up