Overview

  • Product name

    Recombinant Human LHX6 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIES QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
    • Amino acids

      274 to 363
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • LHX 6
    • LHX 6.1
    • LHX6
    • LHX6.1
    • LHX6_HUMAN
    • LIM homeobox 6
    • LIM homeobox protein 6
    • LIM homeodomain protein 6.1
    • LIM/homeobox protein Lhx6
    • LIM/homeobox protein Lhx6.1
    • MGC119542
    • MGC119544
    • MGC119545
    • OTTHUMP00000064113
    • OTTHUMP00000064114
    see all
  • Function

    Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153276 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up