Description

  • Product name

    Recombinant human LIF protein (Active)
    See all LIF proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of >1.0 x 107 IU/mg.

  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGE PFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRD QKILNPSALSLHSKLNATAD ILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYK QIIAVLAQAF
    • Predicted molecular weight

      20 kDa
    • Amino acids

      23 to 202
    • Additional sequence information

      Full-length mature chain lacking the signal sequence.

Specifications

Our Abpromise guarantee covers the use of ab237549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • CDF
    • Cholinergic Differentiation Factor
    • D factor
    • DIA
    • Differentiation inducing factor
    • differentiation inhibitory activity
    • Differentiation stimulating factor
    • Differentiation-stimulating factor
    • Emfilermin
    • Hepatocyte stimulating factor III
    • HILDA
    • Human interleukin in DA cells
    • Leukemia inhibitory factor
    • LIF
    • LIF_HUMAN
    • Melanoma derived LPL inhibitor
    • Melanoma-derived LPL inhibitor
    • MLPLI
    see all
  • Function

    LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
  • Sequence similarities

    Belongs to the LIF/OSM family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab237549.

References

ab237549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up