Recombinant Human LILRA2 protein (ab161252)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEH QAQQNQAEFRMG
    • Amino acids
      322 to 383
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD85 antigen-like family member H
    • CD85h
    • ILT-1
    • ILT1
    • Immunoglobulin like transcript 1
    • Immunoglobulin-like transcript 1
    • Leukocyte immunoglobulin like receptor 7
    • Leukocyte immunoglobulin like receptor subfamily A member 2
    • Leukocyte immunoglobulin-like receptor 7
    • Leukocyte immunoglobulin-like receptor subfamily A member 2
    • LILRA2
    • LIR-7
    • LIR7
    • LIRA2_HUMAN
    see all
  • Function
    Does not bind class I MHC antigens.
  • Tissue specificity
    Expression levels are very low or not detectable on monocytes, T-cells, B-cells, dendritic cells and natural killer (NK) cells.
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161252 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161252 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up