Description

  • Product name

    Recombinant Human LILRA3 protein (Fc Chimera)
    See all LILRA3 proteins and peptides
  • Purity

    >= 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRI PQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYS KPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSH ARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVS KKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQP QAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIR ARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKR QSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAA ETLSPPQNKSDSKAGE
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      24 to 439
    • Additional sequence information

      Mature full length protein, without signal peptide, fused with a human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab216223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µL sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. No activity loss was observed after storage at: In lyophilized state for 1 year (4C); After reconstitution under sterile conditions for 3 months (-80C)

General Info

  • Alternative names

    • CD 85E
    • CD85 antigen-like family member E
    • CD85e
    • CD85e antigen
    • e3
    • HM 31
    • HM 43
    • HM31
    • HM43
    • ILT 6
    • ILT-6
    • ILT6
    • Immunoglobulin like transcript 6
    • Immunoglobulin-like transcript 6
    • Leucocyte immunoglobulin like receptor
    • Leukocyte immunoglobulin like receptor 4
    • Leukocyte immunoglobulin like receptor A3
    • Leukocyte immunoglobulin like receptor subfamily A (without TM domain) member 3
    • Leukocyte immunoglobulin like receptor subfamily A member 3
    • Leukocyte immunoglobulin-like receptor 4
    • Leukocyte immunoglobulin-like receptor subfamily A member 3
    • LILRA 3
    • LILRA3
    • LIR 4
    • LIR-4
    • LIR4
    • LIRA3_HUMAN
    • Monocyte inhibitory receptor HM43/HM31
    see all
  • Function

    May act as soluble receptor for class I MHC antigens.
  • Tissue specificity

    Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung.
  • Sequence similarities

    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab216223 was determined by SDS-PAGE under reducing conditions and staining overnight with Coomassie Blue.

References

ab216223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up