Recombinant Human LILRA3 protein (Tagged) (Biotin) (ab246218)

Description

  • Product name

    Recombinant Human LILRA3 protein (Tagged) (Biotin)
    See all LILRA3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRI PQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYS KPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSH ARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVS KKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQP QAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIR ARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKR QSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAA ETLSPPQNKSDSKAGE
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      24 to 439
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AAH28208.1. Full length mature chain without signal peptide. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • CD 85E
    • CD85 antigen-like family member E
    • CD85e
    • CD85e antigen
    • e3
    • HM 31
    • HM 43
    • HM31
    • HM43
    • ILT 6
    • ILT-6
    • ILT6
    • Immunoglobulin like transcript 6
    • Immunoglobulin-like transcript 6
    • Leucocyte immunoglobulin like receptor
    • Leukocyte immunoglobulin like receptor 4
    • Leukocyte immunoglobulin like receptor A3
    • Leukocyte immunoglobulin like receptor subfamily A (without TM domain) member 3
    • Leukocyte immunoglobulin like receptor subfamily A member 3
    • Leukocyte immunoglobulin-like receptor 4
    • Leukocyte immunoglobulin-like receptor subfamily A member 3
    • LILRA 3
    • LILRA3
    • LIR 4
    • LIR-4
    • LIR4
    • LIRA3_HUMAN
    • Monocyte inhibitory receptor HM43/HM31
    see all
  • Function

    May act as soluble receptor for class I MHC antigens.
  • Tissue specificity

    Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung.
  • Sequence similarities

    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human LILRA3 protein (Tagged) (Biotin) (ab246218).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 65-80 kDa under reducing conditions due to glycosylation.

References

ab246218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up