Overview

  • Product name
    Recombinant Human LIM domain only 3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEV GSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHL DCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
    • Amino acids
      1 to 145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAT 1
    • DAT1
    • LIM domain only 3 (rhombotin like 2)
    • LIM domain only protein 3
    • LMO 3
    • LMO-3
    • lmo3
    • LMO3_HUMAN
    • MGC26081
    • Neuronal specific transcription factor DAT1
    • Neuronal-specific transcription factor DAT1
    • RBTN 3
    • RBTN3
    • RBTNL 2
    • RBTNL2
    • RHOM 3
    • RHOM3
    • Rhombotin 3
    • Rhombotin like 2
    • Rhombotin-3
    • Rhombotin3
    see all
  • Sequence similarities
    Contains 2 LIM zinc-binding domains.
  • Information by UniProt

Images

  • ab163265 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up