Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRAR LQGSATAAEASLLRRTHLCSLSKSDTRLHELHRGPRSSRALRPASMDLLR PHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAGLEATYSNVGL AALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLY SRVCKPKRRDPGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPL ENVYESIRELGDPAGRSSTCGAGTPPASSCPSLGRGWRPLPASLP
    • Amino acids
      1 to 295
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ583P15.4
    • FLJ20406
    • Lck interacting membrane protein
    • Lck interacting molecule
    • Lck interacting transmembrane adaptor 1
    • LIME 1
    • LIME1
    • LP8067
    • RP4 583P15.5
    see all
  • Relevance
    LIME (Lck-interacting molecule) is a new raft-associated adaptor protein involved in regulation of T cell activation by coreceptors. LIME becomes tyrosine phosphorylated after cross-linking of the CD4 or CD8 coreceptors. Phospho-LIME associates with the Src family kinase Lck and its negative regulator, Csk. Ectopic expression of LIME in Jurkat T cells results in an increase of Csk in lipid rafts, increased phosphorylation of Lck and higher Ca2+ response to CD3 stimulation.
  • Cellular localization
    Cell membrane; Single-pass type III membrane protein. Present in lipid rafts. Recruited to the immunological synapse upon conjugation of T cell with antigen presenting cell

Images

  • ab162894 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up