Overview

  • Product name
    Recombinant human LIMK1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIF RPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKE VKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPW SQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARL MVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFS FGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITV RCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR GESG
    • Molecular weight
      65 kDa including tags
    • Amino acids
      285 to 638
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of LIMK1 was determined to be 8 nmol/min/mg.

  • Applications

    SDS-PAGE

    Western blot

    Functional Studies

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Additional notes

    ab85154 (Human Cofilin full length protein) and ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • EC 2.7.11.1
    • LIM domain kinase 1
    • LIM motif-containing protein kinase
    • LIMK
    • LIMK-1
    • limk1
    • LIMK1_HUMAN
    see all
  • Function
    Protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes.
  • Tissue specificity
    Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.
  • Involvement in disease
    Note=LIMK1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 2 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
    Phosphorylated on serine and/or threonine residues by ROCK1. May be dephosphorylated and inactivated by SSH1.
    Ubiquitinated. 'Lys-48'-linked polyubiquitination by RNF6 leads to proteasomal degradation through the 26S proteasome, modulating LIMK1 levels in the growth cone and its effect on axonal outgrowth. Also polyubiquitinated by RLIM.
  • Cellular localization
    Cytoplasm. Cell projection > growth cone.
  • Information by UniProt

Images

  • Kinase Assay demonstrating specific activity of ab174066

  • SDS-PAGE showing ab174066

References

ab174066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up