Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSYLSVPAYFTSRDLFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGEF CHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYC GKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVES ACSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVE DAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDT KENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSY SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQK TFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMD PFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFG LSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGK SYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTD CPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYD PKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDELLDMESDDAWAS RVKELLVDCYKPTEAFISGLLDKIRAMQKLSTPQKK
    • Amino acids
      1 to 686
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as LIM kinase 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LIM domain kinase 2
    • LIM kinase 2
    • LIMK 2
    • LIMK-2
    • Limk2
    • LIMK2_HUMAN
    see all
  • Function
    Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
  • Tissue specificity
    Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 2 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated on serine and/or threonine residues by ROCK1.
  • Cellular localization
    Cytoplasm. Nucleus. Isoform LIMK2a is distributed in the cytoplasm and the nucleus and Cytoplasm. Nucleus. Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus.
  • Information by UniProt

Images

  • ab158820 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up