Description

  • Product name

    Recombinant human LIMK2 protein 
  • Biological activity

    The specific activity of ab207944 was found to be 3 nmol/min/mg.

  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNW YYEKDGKLYCPKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMS CKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTESVQEQLPYSV TLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHP GDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLE ARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTH KATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKK LNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHR DLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDR KKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCL PRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
    • Predicted molecular weight

      96 kDa including tags
    • Amino acids

      1 to 638
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      CR456513.
  • Description

    Recombinant human LIMK2 protein

Specifications

Our Abpromise guarantee covers the use of ab207944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as LIM kinase 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.004% DTT, 0.003% EDTA, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • LIM domain kinase 2
    • LIM kinase 2
    • LIMK 2
    • LIMK-2
    • Limk2
    • LIMK2_HUMAN
    see all
  • Function

    Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
  • Tissue specificity

    Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 2 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on serine and/or threonine residues by ROCK1.
  • Cellular localization

    Cytoplasm. Nucleus. Isoform LIMK2a is distributed in the cytoplasm and the nucleus and Cytoplasm. Nucleus. Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207944.

  • Sample Kinase Activity assay plot using ab207944, showing the specific activity to be 3 nmol/min/mg.

References

ab207944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up