Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      RVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEIL RGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVG DPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDEL LWGYKDEILSLIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFT KIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRS VYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNV SICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGII LKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLK SMINTTLDHHHHHH
    • Molecular weight

      48 kDa including tags
    • Amino acids

      27 to 432
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • 85 kDa lysosomal membrane sialoglycoprotein
    • 85 kDa lysosomal sialoglycoprotein scavenger receptor class B member 2
    • AMRF
    • CD36
    • CD36 antigen
    • CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II)
    • CD36 antigen-like 2
    • CD36L2
    • EPM4
    • HLGP85
    • LGP85
    • LIMP 2
    • LIMP II
    • LIMP2
    • LIMPII
    • Lysosomal integral membrane protein II
    • Lysosome membrane protein 2
    • Lysosome membrane protein II
    • OTTHUMP00000160590
    • OTTHUMP00000219176
    • Scarb2
    • Scavenger receptor class B member 2
    • Scavenger receptor class B, member 2
    • SCRB2_HUMAN
    • SR BII
    • SRBII
    see all
  • Function

    Acts as a lysosomal receptor for glucosylceramidase (GBA) targeting.
    (Microbial infection) Acts as a receptor for enterovirus 71.
  • Involvement in disease

    Epilepsy, progressive myoclonic 4, with or without renal failure
    Genetic variants in SCARB2 can act as modifier of the phenotypic expression and severity of Gaucher disease.
  • Sequence similarities

    Belongs to the CD36 family.
  • Cellular localization

    Lysosome membrane.
  • Information by UniProt

References

ab152019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up