Recombinant Human LIN7A protein (ab134591)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human LIN7A protein -
Purity
> 90 % SDS-PAGE.
ab134591 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLKPSVTSAPTADMATLTVVQPLTLDR DVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETIT VNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKE QNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKA AKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQT QQNHMS -
Predicted molecular weight
28 kDa including tags -
Amino acids
1 to 233 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab134591 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- hLin-7
- Lin 7 homolog A (C. elegans)
- LIN 7A
see all -
Function
Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. -
Tissue specificity
Expressed in brain, testis, kidney, placenta and liver. -
Sequence similarities
Belongs to the lin-7 family.
Contains 1 L27 domain.
Contains 1 PDZ (DHR) domain. -
Domain
The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.
The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.
The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes. -
Cellular localization
Cell membrane. Basolateral cell membrane. Cell junction. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > tight junction. Cell junction > synapse > synaptosome. Enriched in synaptosomes and at epithelial cell-cell junctions (By similarity). Mainly basolateral in renal epithelial cells. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab134591 has not yet been referenced specifically in any publications.