Description

  • Product name

    Recombinant Human LIN7A protein
  • Purity

    > 90 % SDS-PAGE.
    ab134591 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLKPSVTSAPTADMATLTVVQPLTLDR DVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETIT VNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKE QNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKA AKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQT QQNHMS
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      1 to 233
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • hLin-7
    • Lin 7 homolog A (C. elegans)
    • LIN 7A
    • Lin-7A
    • LIN7
    • LIN7A
    • LIN7A_HUMAN
    • MALS-1
    • Mammalian LIN 7 1
    • Mammalian lin-seven protein 1
    • Protein lin-7 homolog A
    • Tax interaction protein 33
    • TIP-33
    • Veli-1
    • VELI1
    • Vertebrate lin-7 homolog 1
    • Vertebrate LIN7 homolog 1
    see all
  • Function

    Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
  • Tissue specificity

    Expressed in brain, testis, kidney, placenta and liver.
  • Sequence similarities

    Belongs to the lin-7 family.
    Contains 1 L27 domain.
    Contains 1 PDZ (DHR) domain.
  • Domain

    The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.
    The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.
    The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes.
  • Cellular localization

    Cell membrane. Basolateral cell membrane. Cell junction. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > tight junction. Cell junction > synapse > synaptosome. Enriched in synaptosomes and at epithelial cell-cell junctions (By similarity). Mainly basolateral in renal epithelial cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134591.

References

ab134591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up