Description

  • Product name

    Recombinant Human LIN9/TGS protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHRGGQPLKKRRGSFKMAELDQLPDESSSAKALVSLKEGSLSNTWNEKYS SLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVA MVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKP LFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEE RSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVTARLRGVH DGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAA FGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTET LGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEF QRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRR CEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEGGDLN SFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF AANNTNRD
    • Amino acids

      1 to 558
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BARA
    • Beta subunit-associated regulator of apoptosis
    • Beta-subunit associated regulator of apoptosis
    • hLin-9
    • huLin-9
    • lin-9
    • lin9
    • LIN9_HUMAN
    • pRB-associated protein
    • Protein lin-9 homolog
    • TGS
    • TUDOR gene similar protein
    • Type I interferon receptor beta chain-associated protein
    see all
  • Function

    Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition.
  • Tissue specificity

    Expressed in thymus and testis.
  • Sequence similarities

    Belongs to the lin-9 family.
  • Cellular localization

    Nucleus > nucleoplasm. Found in perinucleolar structures. Associated with chromatin.
  • Information by UniProt

Images

  • ab153641 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up