Description

  • Product name

    Recombinant Human Lingo1 protein (denatured)
    See all Lingo1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSLKVLEISHWPYLDT MTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEG SMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYL
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      241 to 337
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_116197

Specifications

Our Abpromise guarantee covers the use of ab202603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • FLJ14594
    • LERN 1
    • LERN1
    • Leucine rich repeat and Ig domain containing 1
    • Leucine rich repeat neuronal 6A
    • Leucine rich repeat neuronal protein 1
    • Leucine rich repeat neuronal protein 6A
    • Leucine-rich repeat and immunoglobilin domain-containing protein 1
    • Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
    • Leucine-rich repeat neuronal protein 1
    • Leucine-rich repeat neuronal protein 6A
    • LIGO1_HUMAN
    • Lingo 1
    • LINGO1
    • LRR and Ig domain containing Nogo Receptor interating protein
    • Lrrn 6a
    • Lrrn6a
    • Lrrn6a protein
    • MGC17422
    • Nogo Receptor interacting protein
    • PRO227
    • UNQ201
    see all
  • Function

    Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination. Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.
  • Tissue specificity

    Expressed exclusively in the central nervous system. Highest level in the in amygdala, hippocampus, thalamus and cerebral cortex. In the rest of the brain a basal expression seems to be always present. Up-regulated in substantia nigra neurons from Parkinson disease patients.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    N-glycosylated. Contains predominantly high-mannose glycans.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of ab202603.

References

ab202603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up