Description

  • Product name

    Recombinant Human LIPH protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLRFYLFISLLCLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKN LTCAQTINSSAFGNLNVTKKTTFIVHGFRPTGSPPVWMDDLVKGLLSVED MNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLDDIYM IGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQF VDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQR SVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYAD NWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNVRRGDITIK LRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGS LIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ L
    • Amino acids

      1 to 451
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AH
    • ARWH2
    • LAH2
    • Lipase H
    • Lipase member H
    • LIPH
    • LIPH_HUMAN
    • LPD lipase related protein
    • LPD lipase-related protein
    • LPDLR
    • Membrane associated phosphatidic acid selective phospholipase A1 alpha
    • Membrane bound phosphatidic acid selective phospholipase A1
    • Membrane-associated phosphatidic acid-selective phospholipase A1-alpha
    • mPA PLA1
    • mPA-PLA1 alpha
    • MPAPLA1
    • OTTHUMP00000210343
    • OTTHUMP00000210344
    • Phospholipase A1 member B
    • PLA1B
    see all
  • Function

    Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG).
  • Tissue specificity

    Present in intestine (at protein level). Expressed in colon, prostate, kidney, pancreas, ovary, testis, intestine, lung and pancreas. Expressed at lower level in brain, spleen and heart. In hair, it is prominently expressed in hair follicles, including the stem cell-rich bulge region.
  • Involvement in disease

    Defects in LIPH are the cause of hypotrichosis localized autosomal recessive type 2 (LAH2) [MIM:604379]; also known as alopecia universalis congenita Mari type. A condition characterized by the presence of less than the normal amount of hair. Affected individuals have sparse or absent scalp, axillary and body hair and sparse eyebrows and eyelashes.
    Defects in LIPH are the cause of woolly hair autosomal recessive type 2 (ARWH2) [MIM:604379]. A hair shaft disorder characterized by fine and tightly curled hair. Compared to normal curly hair that is observed in some populations, woolly hair grows slowly and stops growing after a few inches. Under light microscopy, woolly hair shows some structural anomalies, including trichorrexis nodosa and tapered ends. Some individuals may present with hypotrichosis.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization

    Secreted. Membrane.
  • Information by UniProt

Images

  • ab165870 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165870 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up