Description

  • Product name

    Recombinant Human Lipoprotein lipase
    See all Lipoprotein lipase proteins and peptides
  • Purity

    > 80 % Densitometry.
    ab115504 is filtered (0.4 µm).
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HVDYKDDDDKPAGADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESV ATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWL SRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHA AGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTR GSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLV KCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLG YEISKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEI SLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSY FSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVK CHDKSLNKKSG
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      28 to 475
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 0.24% Tris buffer, 0.29% Sodium chloride

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.

General Info

  • Alternative names

    • EC 3.1.1
    • EC 3.1.1.34
    • HDLCQ11
    • LIPD
    • LIPL_HUMAN
    • Lipoprotein lipase
    • LPL
    • LPL protein
    • MGC137861
    see all
  • Function

    The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium.
  • Involvement in disease

    Defects in LPL are the cause of lipoprotein lipase deficiency (LPL deficiency) [MIM:238600]; also known as familial chylomicronemia or hyperlipoproteinemia type I. LPL deficiency chylomicronemia is a recessive disorder usually manifesting in childhood. On a normal diet, patients often present with abdominal pain, hepatosplenomegaly, lipemia retinalis, eruptive xanthomata, and massive hypertriglyceridemia, sometimes complicated with acute pancreatitis.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Post-translational
    modifications

    Tyrosine nitration after lipopolysaccharide (LPS) challenge down-regulates the lipase activity.
  • Cellular localization

    Cell membrane. Secreted. Locates to the plasma membrane of microvilli of hepatocytes with triacyl-glycerol-rich lipoproteins (TRL). Some of the bound LPL is then internalized and located inside non-coated endocytic vesicles.
  • Information by UniProt

Images

  • 14% SDS-PAGE showing ab115504
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5μg/lane.
    Lane 3: non-reduced and non-boiled sample, 5μg/lane.

References

ab115504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up