Overview

  • Product name
    Recombinant Human LIPT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDW IHDHMNLEGKPILFFWQNSPSVVIGRHQNPWQECNLNLMREEGIKLARRR SGGGTVYHDMGNINLTFFTTKKKYDRMENLKLIVRALNAVQPQLDVQATK RFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFLSSLLKSPYQGI RSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQIDNHIHLINP TDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFI DIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLR TCPQDHKLNSKWNILCEKIKGIM
    • Amino acids
      1 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lipoate biosynthesis protein
    • Lipoate-protein ligase
    • Lipoyl ligase
    • Lipoyltransferase 1
    • Lipoyltransferase 1 mitochondrial
    • LIPT_HUMAN
    • Lipt1
    • mitochondrial
    see all
  • Function
    Catalyzes the transfer of the lipoyl group from lipoyl-AMP to the specific lysine residue of lipoyl domains of lipoate-dependent enzymes.
  • Tissue specificity
    Highly expressed in skeletal muscle and heart, moderately in kidney and pancreas, and detected at lower levels in liver, brain, placenta and lung.
  • Pathway
    Protein modification; protein lipoylation via exogenous pathway; protein N(6)-(lipoyl)lysine from lipoate: step 2/2.
  • Sequence similarities
    Belongs to the lplA family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab162605 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up