Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTP PQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCL YLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVT IQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTI FGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQ IAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQP LLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIPMLMSYPL SEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFL DLIADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDH GDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWP EYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEVDHHH HHH
    • Molecular weight

      61 kDa including tags
    • Amino acids

      18 to 563
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Thr purity of ab151864 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Liver Carboxylesterase 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituents: Sodium Acetate Buffer, 0.88% Sodium chloride

General Info

  • Alternative names

    • ACAT
    • Acyl coenzyme A cholesterol acyltransferase
    • Acyl-coenzyme A:cholesterol acyltransferase
    • Brain carboxylesterase hBr1
    • Carboxyesterase ES-3
    • Carboxylesterase
    • Carboxylesterase 1
    • Carboxylesterase 1 (monocyte/macrophage serine esterase 1)
    • Carboxylesterase 1 deficiency, included
    • Carboxylesterase 2, formerly
    • CE 1
    • CEH
    • Ces-1
    • CES1
    • CES2
    • CESDD1
    • Cholesterol ester hydrolase, neutral, macrophage-derived
    • Cholesteryl ester hydrolase
    • Cocaine carboxylesterase
    • EC 3.1.1.1
    • Egasyn
    • ES-HTEL
    • ES-x
    • Es22
    • EST1_HUMAN
    • Esterase
    • Esterase 22
    • hCE 1
    • HMSE
    • HMSE1
    • Liver carboxylesterase 1
    • Liver carboxylesterase 3
    • Methylumbelliferyl acetate deacetylase 1
    • MGC117365
    • MGC156521
    • Monocyte carboxylesterase deficiency, included
    • Monocyte esterase deficiency, included
    • Monocyte/macrophage serine esterase
    • PCE-1
    • pI 5.5 esterase
    • Proline-beta-naphthylamidase
    • REH
    • Retinyl ester hydrolase
    • Serine esterase 1
    • Ses-1
    • SES1
    • TGH
    • Triacylglycerol hydrolase
    see all
  • Function

    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl-CoA ester. Hydrolyzes the methyl ester group of cocaine to form benzoylecgonine. Catalyzes the transesterification of cocaine to form cocaethylene. Displays fatty acid ethyl ester synthase activity, catalyzing the ethyl esterification of oleic acid to ethyloleate.
  • Tissue specificity

    Expressed predominantly in liver with lower levels in heart and lung.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Post-translational
    modifications

    Contains sialic acid.
    Cleavage of the signal sequence can occur at 2 positions, either between Trp-17 and Gly-18 or between Gly-18 and His-19.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

References

This product has been referenced in:

  • Boberg M  et al. Age-Dependent Absolute Abundance of Hepatic Carboxylesterases (CES1 and CES2) by LC-MS/MS Proteomics: Application to PBPK Modeling of Oseltamivir In Vivo Pharmacokinetics in Infants. Drug Metab Dispos 45:216-223 (2017). Read more (PubMed: 27895113) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up