For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-liver-carboxylesterase-1ces1-protein-ab151864.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Lipids / Lipoproteins Lipid Metabolism Cholesterol Metabolism
Share by email

Recombinant Human Liver Carboxylesterase 1/CES1 protein (ab151864)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Tags: His tag C-Terminus
  • Suitable for: SDS-PAGE, HPLC

Description

  • Product name

    Recombinant Human Liver Carboxylesterase 1/CES1 protein
    See all Liver Carboxylesterase 1/CES1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Thr purity of ab151864 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P23141
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTP PQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCL YLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVT IQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTI FGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQ IAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQP LLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIPMLMSYPL SEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFL DLIADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDH GDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWP EYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEVDHHH HHH
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      18 to 563
    • Tags

      His tag C-Terminus

Associated products

  • Related Products

    • Anti-Liver Carboxylesterase 1/CES1 antibody (ab115280)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab151864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Liver Carboxylesterase 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituents: Sodium Acetate Buffer, 0.88% Sodium chloride

General Info

  • Alternative names

    • ACAT
    • Acyl coenzyme A cholesterol acyltransferase
    • Acyl-coenzyme A:cholesterol acyltransferase
    • Brain carboxylesterase hBr1
    • Carboxyesterase ES-3
    • Carboxylesterase
    • Carboxylesterase 1
    • Carboxylesterase 1 (monocyte/macrophage serine esterase 1)
    • Carboxylesterase 1 deficiency, included
    • Carboxylesterase 2, formerly
    • CE 1
    • CEH
    • Ces-1
    • CES1
    • CES2
    • CESDD1
    • Cholesterol ester hydrolase, neutral, macrophage-derived
    • Cholesteryl ester hydrolase
    • Cocaine carboxylesterase
    • EC 3.1.1.1
    • Egasyn
    • ES-HTEL
    • ES-x
    • Es22
    • EST1_HUMAN
    • Esterase
    • Esterase 22
    • hCE 1
    • HMSE
    • HMSE1
    • Liver carboxylesterase 1
    • Liver carboxylesterase 3
    • Methylumbelliferyl acetate deacetylase 1
    • MGC117365
    • MGC156521
    • Monocyte carboxylesterase deficiency, included
    • Monocyte esterase deficiency, included
    • Monocyte/macrophage serine esterase
    • PCE-1
    • pI 5.5 esterase
    • Proline-beta-naphthylamidase
    • REH
    • Retinyl ester hydrolase
    • Serine esterase 1
    • Ses-1
    • SES1
    • TGH
    • Triacylglycerol hydrolase
    see all
  • Function

    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl-CoA ester. Hydrolyzes the methyl ester group of cocaine to form benzoylecgonine. Catalyzes the transesterification of cocaine to form cocaethylene. Displays fatty acid ethyl ester synthase activity, catalyzing the ethyl esterification of oleic acid to ethyloleate.
  • Tissue specificity

    Expressed predominantly in liver with lower levels in heart and lung.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Post-translational
    modifications

    Contains sialic acid.
    Cleavage of the signal sequence can occur at 2 positions, either between Trp-17 and Gly-18 or between Gly-18 and His-19.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Target information above from: UniProt accession P23141 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab151864? Please let us know so that we can cite the reference in this datasheet.

ab151864 has been referenced in 1 publication.

  • Boberg M  et al. Age-Dependent Absolute Abundance of Hepatic Carboxylesterases (CES1 and CES2) by LC-MS/MS Proteomics: Application to PBPK Modeling of Oseltamivir In Vivo Pharmacokinetics in Infants. Drug Metab Dispos 45:216-223 (2017). PubMed: 27895113

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab151864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.