Recombinant Human LMBR1L protein (ab163188)

Overview

  • Product name
    Recombinant Human LMBR1L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAPDYEVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEF TTVDDEDATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYY IQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGR VYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSC ISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAA LTRRICNPTSCWLPLDMELLHRQVLALQTQRVLLEKRRKASAWQRNLGYP LAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGS FGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLL VLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLC LVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ
    • Amino acids
      1 to 489
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10494
    • FLJ36251
    • KIAA1174
    • Limb region 1 homolog (mouse) like
    • Limb region 1 protein homolog like
    • LIMR
    • Lipocalin 1 interacting membrane receptor
    • Lipocalin interacting membrane receptor
    • Protein LMBR1L
    see all
  • Relevance
    LMBR1L is a probable LCN1 receptor and may mediate LCN1 endocytosis.
  • Cellular localization
    Cell Membrane; Multi-pass membrane protein.

Images

  • ab163188 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up