Description

  • Product name

    Recombinant Human LMO1 protein
    See all LMO1 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLK CACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA
    • Amino acids

      1 to 90
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cysteine rich protein TTG 1
    • Cysteine rich protein TTG1
    • Cysteine-rich protein TTG-1
    • LIM domain only 1
    • LIM domain only protein 1
    • LMO 1
    • LMO-1
    • lmo1
    • MGC116692
    • RBTN 1
    • RBTN1
    • RBTN1_HUMAN
    • RHOM 1
    • RHOM1
    • Rhombotin 1
    • Rhombotin-1
    • Rhombotin1
    • T cell translocation protein 1
    • T-cell translocation protein 1
    • TTG 1
    • TTG1
    see all
  • Function

    May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
  • Tissue specificity

    Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
  • Involvement in disease

    A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.
  • Sequence similarities

    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab158823 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up