Overview

  • Product name

    Recombinant Human LMO2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYW HEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRPFGQDGLCASCDKR IRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYE WTKINGMI
    • Molecular weight

      43 kDa including tags
    • Amino acids

      1 to 158

Specifications

Our Abpromise guarantee covers the use of ab152503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cysteine rich protein TTG 2
    • Cysteine rich protein TTG2
    • Cysteine-rich protein TTG-2
    • LIM domain only 2
    • LIM domain only 2 (rhombotin like 1)
    • LIM domain only protein 2
    • LMO 2
    • LMO-2
    • lmo2
    • RBTN 2
    • RBTN L1
    • RBTN2
    • RBTN2_HUMAN
    • RBTNL 1
    • RBTNL1
    • RHOM 2
    • RHOM2
    • Rhombotin 2
    • Rhombotin like 1
    • Rhombotin-2
    • Rhombotin2
    • T cell translocation gene 2
    • T cell translocation protein 2
    • T-cell translocation protein 2
    • TTG 2
    • TTG2
    see all
  • Function

    Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.
  • Involvement in disease

    Note=A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.
  • Sequence similarities

    Contains 2 LIM zinc-binding domains.
  • Domain

    The second LIM zinc-binding domain interacts with KDM5A.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152503 stained with Coomassie Blue.

References

ab152503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up