Overview

  • Product name
    Recombinant Human LMOD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKK LMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRG GLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRG EERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAP AAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAA IRSSNLKQLKKVEVPKLLQ
    • Amino acids
      1 to 269
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1D
    • 64 kDa autoantigen 1D
    • 64 kDa autoantigen 1D3
    • 64 kDa autoantigen D1
    • 9530015K06Rik
    • D1
    • Leiomodin
    • Leiomodin-1
    • Lmod1
    • LMOD1_HUMAN
    • muscle form
    • SM LMOD
    • SM-Lmod
    • SMLMOD
    • Smooth muscle leiomodin
    • Thyroid associated ophthalmopathy autoantigen
    • Thyroid-associated ophthalmopathy autoantigen
    see all
  • Tissue specificity
    Smooth muscle (heart, skeletal muscle, colon and small intestine), a subset of striated muscle fibers, and at low level in thyroid.
  • Sequence similarities
    Belongs to the tropomodulin family.
    Contains 1 WH2 domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161789 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up