Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMDIATGPESLERCFPRGQTDCAKMLDG IKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWH EECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEF VMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLS SVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILT TQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL ARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPY GSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQAR VGNPIDRLYSMQSSYFAS
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 395
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_002307

Specifications

Our Abpromise guarantee covers the use of ab181911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • LIM homeo box transcription factor 1 beta
    • LIM homeobox transcription factor 1 beta
    • LIM homeobox transcription factor 1-beta
    • LIM-homeobox protein 1.2
    • LIM/homeobox protein 1.2
    • LIM/homeobox protein LMX1B
    • LMX 1.2
    • LMX-1.2
    • LMX1.2
    • LMX1B
    • LMX1B_HUMAN
    • MGC138325
    • MGC142051
    • NPS 1
    • NPS1
    see all
  • Function
    Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels.
  • Tissue specificity
    Expressed in most tissues. Highest levels in testis, thyroid, duodenum, skeletal muscle, and pancreatic islets.
  • Involvement in disease
    Defects in LMX1B are the cause of nail-patella syndrome (NPS) [MIM:161200]; also known as onychoosteodysplasia. NPS is a disease that cause abnormal skeletal patterning and renal dysplasia.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181911 (3µg).

References

ab181911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up