Overview

  • Product name
    Recombinant Human LNPEP protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFS TKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
    • Amino acids
      926 to 1025
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Leucyl-cystinyl aminopeptidase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • angiotensin IV receptor
    • AT (4) receptor
    • CAP
    • Cystinyl aminopeptidase
    • insulin regulated aminopeptidase
    • insulin regulated membrane aminopeptidase
    • insulin responsive aminopeptidase
    • Insulin-regulated membrane aminopeptidase
    • Insulin-responsive aminopeptidase
    • IRAP
    • LCAP_HUMAN
    • Leucyl-cystinyl aminopeptidase
    • LNPEP
    • OTase
    • Oxytocinase
    • P-LAP
    • Placental leucine aminopeptidase
    • PLAP
    • pregnancy serum form
    • vasopressinase
    see all
  • Function
    Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be involved in the inactivation of neuronal peptides in the brain. Cleaves Met-enkephalin and dynorphin. Binds angiotensin IV and may be the angiotensin IV receptor in the brain.
  • Tissue specificity
    Highly expressed in placenta, heart, kidney and small intestine. Detected at lower levels in neuronal cells in the brain, in skeletal muscle, spleen, liver, testes and colon.
  • Sequence similarities
    Belongs to the peptidase M1 family.
  • Post-translational
    modifications
    The pregnancy serum form is derived from the membrane-bound form by proteolytic processing.
    N-glycosylated.
  • Cellular localization
    Cell membrane. In brain only the membrane-bound form is found. The protein resides in intracellular vesicles together with GLUT4 and can then translocate to the cell surface in response to insulin and/or oxytocin. Localization may be determined by dileucine internalization motifs, and/or by interaction with tankyrases and Secreted. During pregnancy serum levels are low in the first trimester, rise progressively during the second and third trimester and decrease rapidly after parturition.
  • Information by UniProt

Images

  • ab158825 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up