Description

  • Product name

    Recombinant Human LOX protein (Tagged)
    See all LOX proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVAD PYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQR VKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEG HKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITD VKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      169 to 417
    • Tags

      His tag C-Terminus , MBP tag N-Terminus
    • Additional sequence information

      Mature chain without signal peptide, without propeptide. N-terminal MBP-tagged and C-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • lox
    • LYOX
    • LYOX_HUMAN
    • Lysyl oxidase
    • MGC105112
    • Protein lysine 6 oxidase
    • Protein-lysine 6-oxidase
    see all
  • Function

    Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of extracellular matrix proteins, may have a direct role in tumor suppression.
  • Tissue specificity

    Heart, placenta, skeletal muscle, kidney, lung and pancreas.
  • Involvement in disease

    Defects in LOX may be a cause of cutis laxa autosomal recessive type 1 (ARCL1) [MIM:219100].
  • Sequence similarities

    Belongs to the lysyl oxidase family.
  • Post-translational
    modifications

    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab235010 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up