Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVAD PYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQR VKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEG HKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITD VKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
    • Molecular weight
      49 kDa including tags
    • Amino acids
      169 to 417
    • Tags
      His tag N-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 169 to 417. The signal peptide and propeptide are not included. N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab235570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names
    • lox
    • LYOX
    • LYOX_HUMAN
    • Lysyl oxidase
    • MGC105112
    • Protein lysine 6 oxidase
    • Protein-lysine 6-oxidase
    see all
  • Function
    Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of extracellular matrix proteins, may have a direct role in tumor suppression.
  • Tissue specificity
    Heart, placenta, skeletal muscle, kidney, lung and pancreas.
  • Involvement in disease
    Defects in LOX may be a cause of cutis laxa autosomal recessive type 1 (ARCL1) [MIM:219100].
  • Sequence similarities
    Belongs to the lysyl oxidase family.
  • Post-translational
    modifications
    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235570.

References

ab235570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up