Description

  • Product name

    Recombinant Human LOXL2 protein (His tag)
    See all LOXL2 proteins and peptides
  • Purity

    >= 65 % SDS-PAGE.

  • Expression system

    Freestyle 293-F cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEGRVEVY YDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDN LHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQ IENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAK NSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSC KLGPQVSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPL VRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEA VTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCN TPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMV VCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDG EDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAM EENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDC HRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECAN FGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDY SNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
    • Predicted molecular weight

      85 kDa including tags
    • Amino acids

      26 to 774
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 26 to 774. The signal peptide is not included. (NM_002318).

Specifications

Our Abpromise guarantee covers the use of ab198452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Expressed in FreeStyle 293-F cells.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Preservative: 1.36% Imidazole
    Constituents: 20% Glycerol, 0.02% Potassium chloride, 0.64% Sodium chloride, 77% PBS

General Info

  • Alternative names

    • LOR 2
    • LOR2
    • LOX L2
    • LOXL 2
    • LOXL2
    • LOXL2_HUMAN
    • Lysyl oxidase homolog 2
    • Lysyl oxidase like 2
    • Lysyl oxidase like protein 2
    • Lysyl oxidase related 2
    • Lysyl oxidase related protein 2
    • Lysyl oxidase related protein WS9 14
    • Lysyl oxidase-like protein 2
    • Lysyl oxidase-related protein 2
    • Lysyl oxidase-related protein WS9-14
    • WS9 14
    see all
  • Tissue specificity

    Expressed in many tissues. Highest expression in reproductive tissues, placenta, uterus and prostate.
  • Sequence similarities

    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications

    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2 μg ab198452 with Coomassie staining.

References

ab198452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up