Overview

  • Product name

    Recombinant Human LPA-2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTN LLVIAAIASNRRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLS LEGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVML IVGVWVAALGLGLLPAHSWHCLCALDRCSRMAPLLSRSYLAVWALSSLLV FLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLVKTVVIILGAF VVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST L
    • Amino acids

      1 to 351
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein previously labeled as EDG4.

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EDG 4
    • EDG-4
    • EDG4
    • Endothelial Cell Differentiation Gene 4
    • Endothelial differentiation lysophosphatidic acid G protein coupled receptor 4
    • FLJ93869
    • G protein coupled receptor
    • IPA2
    • LPA 2
    • LPA receptor 2
    • LPA receptor EDG4
    • LPA-2
    • LPA2
    • LPAR2
    • LPAR2_HUMAN
    • Lysophosphatidic acid receptor 2
    • Lysophosphatidic acid receptor Edg 4
    • Lysophosphatidic acid receptor Edg-4
    • Lysophosphatidic acid receptor EDG4
    see all
  • Function

    Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Plays a key role in phospholipase C-beta (PLC-beta) signaling pathway. Stimulates phospholipase C (PLC) activity in a manner that is independent of RALA activation.
  • Tissue specificity

    Expressed most abundantly in testes and peripheral blood leukocytes with less expression in pancreas, spleen, thymus and prostate. Little or no expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney, ovary, small intestine, or colon.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell surface. Cell membrane. Prior to LPA treatment found predominantly at the cell surface but in the presence of LPA colocalizes with RALA in the endocytic vesicles.
  • Information by UniProt

Images

  • ab152959 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up