Overview

  • Product name
    Recombinant Human LPA-3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSL VIAAVIKNRKFHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVN RWFLRQGLLDSSLTASLTNLLVIAVERHMSIMRMRVHSNLTKKRVTLLIL LVWAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLVFWTVSNLMAFL IMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKTVMTVLGAFVV CWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNK STS
    • Amino acids
      1 to 353
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as EDG7.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium mobilizing lysophosphatidic acid receptor LP A3
    • Calcium mobilizing lysophosphatidic acid receptor LPA 3
    • Calcium mobilizing lysophosphatidic acid receptor LPA3
    • EDG 7
    • Endothelial cell differentiation gene 7
    • Endothelial differentiation lysophosphatidic acid G protein coupled receptor 7
    • FLJ98231
    • GPCR
    • HOFNH 30
    • HOFNH30
    • LP A3
    • LPA 3
    • LPA receptor 3
    • LPA receptor EDG 7
    • LPA receptor EDG7
    • LPA-3
    • LPA3
    • LPAR 3
    • Lpar3
    • LPAR3_HUMAN
    • Lysophosphatidic acid receptor 3
    • Lysophosphatidic acid receptor Edg 7
    • Lysophosphatidic acid receptor Edg-7
    • Lysophosphatidic acid receptor Edg7
    • OTTHUMP00000011573
    • RP4 678I3
    • RP4678I3
    see all
  • Function
    Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. May play a role in the development of ovarian cancer. Seems to be coupled to the G(i)/G(o) and G(q) families of heteromeric G proteins.
  • Tissue specificity
    Most abundantly expressed in prostate, testes, pancreas, and heart, with moderate levels in lung and ovary. No detectable expression in brain, placenta, liver, skeletal muscle, kidney, spleen, thymus, small intestine, colon, or peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab161692 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up