Overview

  • Product name
    Recombinant Human LPCAT3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFL GYPFALFYRHYLFYKETYLIHLFHTFTGLSIAYFNFGNQLYHSLLCIVLQ FLILRLMGRTITAVLTTFCFQMAYLLAGYYYTATGNYDIKWTMPHCVLTL KLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVG PQFSMNHYMKLVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPH ITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL GFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIF KRLKFLGNKELSQGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAARL IQESPTLSKLAAITVLQPFYYLVQQTIHWLFMGYSMTAFCLFTWDKWLKV YKSIYFLGHIFFLSLLFILPYIHKAMVPRKEKLKKME
    • Amino acids
      1 to 487
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1-acylglycerophosphocholine O-acyltransferase
    • 1-acylglycerophosphoserine O-acyltransferase
    • LPCAT
    • Lpcat3
    • LPLAT 5
    • LPSAT
    • Lyso-PC acyltransferase
    • Lyso-PC acyltransferase 3
    • Lyso-PS acyltransferase
    • Lysophosphatidylcholine acyltransferase
    • Lysophosphatidylcholine acyltransferase 3
    • Lysophosphatidylserine acyltransferase
    • Lysophospholipid acyltransferase 5
    • MBOA5
    • MBOA5_HUMAN
    • Membrane-bound O-acyltransferase domain-containing protein 5
    • O-acyltransferase domain-containing protein 5
    see all
  • Function
    Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
  • Tissue specificity
    Highly expressed in liver, pancreas and adipose tissue. Very low expression in skeletal muscle and heart. Detected in neutrophils.
  • Pathway
    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family.
  • Domain
    The di-lysine motif confers endoplasmic reticulum localization.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab160850 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up