Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPTPLTSTASPAA TTPLRRAPLTTHPVGAINQLGPDLPPATAPVPSTRRPPAPNLHVSPELFC EPREVRRVQW
    • Amino acids
      381 to 490
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium independent alpha latrotoxin receptor 1
    • Calcium-independent alpha-latrotoxin receptor 1
    • CIRL-1
    • CIRL1
    • CL1
    • CLIBA
    • G protein-coupled receptor for alpha-Latrotoxin
    • KIAA0821
    • Latrophilin 1
    • Latrophilin-1
    • Latrophilin1
    • LEC2
    • Lectomedin 2
    • Lectomedin-2
    • LPHN 1
    • LPHN1
    • LPHN1_HUMAN
    see all
  • Function
    Calcium-independent receptor of high affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor for TENM2 that mediates heterophilic synaptic cell-cell contact and postsynaptic specialization. Receptor propably implicated in the regulation of exocytosis.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 1 GPS domain.
    Contains 1 olfactomedin-like domain.
    Contains 1 SUEL-type lectin domain.
  • Domain
    The extracellular domain coupled to the a single transmembrane region are sufficient for full responsiveness to alpha-latrotoxin.
  • Post-translational
    modifications
    Autoproteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit. This proteolytic processing takes place early in the biosynthetic pathway, either in the endoplasmic reticulum or in the early compartment of the Golgi apparatus.
  • Cellular localization
    Cell membrane. Cell projection > axon. Cell projection > growth cone. Cell junction > synapse. Cell junction > synapse > presynaptic cell membrane. Cell junction > synapse > synaptosome. Colocalizes with TENM2 on the cell surface, across intercellular junctions and on nerve terminals near synaptic clefts.
  • Information by UniProt

Images

  • ab161447 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up