Description

  • Product name

    Recombinant Human LPLA2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTV NLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
    • Amino acids

      314 to 412
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1 O acylceramide synthase
    • 1-O-acylceramide synthase
    • ACS
    • DKFZp564A0122
    • Group XV phospholipase A2
    • GXVPLA 2
    • GXVPLA2
    • LCAT like lysophospholipase
    • LCAT-like lysophospholipase
    • LLPL
    • LPLA 2
    • LPLA2
    • LYPLA 3
    • LYPLA3
    • Lysophospholipase 3
    • Lysophospholipase 3 (lysosomal phospholipase A2)
    • Lysosomal phospholipase A2
    • OTTHUMP00000174859
    • PAG15_HUMAN
    • Phospholipase A2, group XV
    • PLA2G15
    • UNQ341/PRO540
    see all
  • Function

    Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid (By similarity). May have weak lysophospholipase activity.
  • Tissue specificity

    Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Lysosome. Secreted.
  • Information by UniProt

Images

  • ab161739 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up