Overview

  • Product name
    Recombinant Human LRP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGE RDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMD GSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKD FDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPV LLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDS AAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
    • Amino acids
      1 to 292
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      This protein is the full length sequence for isoform 2 (UniProt: Q07954-2), which is 292 amino acids. It is not the canonical isoform 1 sequence (4,544 amino acids).

Specifications

Our Abpromise guarantee covers the use of ab158828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2MR
    • Alpha 2 macroglobulin receptor
    • alpha 2MR
    • Alpha-2-macroglobulin receptor
    • APOER
    • Apolipoprotein E receptor
    • APR
    • CD 91
    • CD91
    • CD91 antigen
    • IGFBP3R
    • LDL receptor related protein 1
    • Low density lipoprotein receptor related protein 1
    • Low density lipoprotein related protein 1
    • Low-density lipoprotein receptor-related protein 1 intracellular domain
    • LRP
    • LRP 1
    • LRP 515
    • LRP 85
    • LRP ICD
    • LRP-1
    • LRP-515
    • LRP-85
    • Lrp1
    • LRP1 protein
    • LRP1_HUMAN
    • LRP1A
    • LRP515
    • LRP85
    • LRPICD
    • MGC88725
    • Prolow density lipoprotein receptor related protein 1
    • TbetaR V/LRP 1/IGFBP 3 receptor
    • TbetaRV/LRP1/IGFBP3 receptor
    • TGFBR 5
    • TGFBR5
    • Type V tgf beta receptor
    see all
  • Function
    Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Required for early embryonic development. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. May modulate cellular events, such as APP metabolism, kinase-dependent intracellular signaling, neuronal calcium signaling as well as neurotransmission.
    Functions as a receptor for Pseudomonas aeruginosa exotoxin A.
  • Tissue specificity
    Most abundant in liver, brain and lung.
  • Sequence similarities
    Belongs to the LDLR family.
    Contains 22 EGF-like domains.
    Contains 31 LDL-receptor class A domains.
    Contains 34 LDL-receptor class B repeats.
  • Post-translational
    modifications
    Cleaved into a 85 kDa membrane-spanning subunit (LRP-85) and a 515 kDa large extracellular domain (LRP-515) that remains non-covalently associated. Gamma-secretase-dependent cleavage of LRP-85 releases the intracellular domain from the membrane.
    The N-terminus is blocked.
    Phosphorylated on serine and threonine residues.
    Phosphorylated on tyrosine residues upon stimulation with PDGF. Tyrosine phosphorylation promotes interaction with SHC1.
  • Cellular localization
    Cytoplasm. Nucleus. After cleavage, the intracellular domain (LRPICD) is detected both in the cytoplasm and in the nucleus and Cell membrane. Membrane, coated pit.
  • Information by UniProt

Images

  • ab158828 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up