Description

  • Product name

    Recombinant Human LRP2BP protein
  • Purity

    > 95 % SDS-PAGE.
    ab202172 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMKLTSEKLPKNPFYASVSQYAAKNQKF FQWKKEKTDYTHANLVDKALQLLKERILKGDTLAYFLRGQLYFEEGWYEE ALEQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPCPK ARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQS MLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDT EAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHD IPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKA CRLNPALADELHSLLIRQRI
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 347
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_060879.

Specifications

Our Abpromise guarantee covers the use of ab202172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 79% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • DKFZp761O0113
    • FLJ44965
    • KIAA1325
    • LR2BP_HUMAN
    • LRP2 binding protein
    • LRP2-binding protein
    • Lrp2bp
    • Megalin binding protein
    • Megalin-binding protein
    • MegBP
    see all
  • Function

    May act as an adapter that regulates LRP2 function.
  • Sequence similarities

    Contains 6 Sel1-like repeats.
    Contains 1 TPR repeat.
  • Cellular localization

    Cytoplasm. Detected in a vesicular staining pattern close to the plasma membrane and throughout the cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202172.

References

ab202172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up